DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and crispl

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:220 Identity:51/220 - (23%)
Similarity:80/220 - (36%) Gaps:52/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYV 125
            |..:|.|.|:.|.....       |.|.|..:.| .:||  ||.|.:..:....|.|...|.:..
 Frog   108 RQSILNVHNELRRNANP-------PPSNMLKMVW-SDLA--AKSAAKWANSCKQYHSLKPERTIP 162

  Fly   126 SYIYGSTKWLQLEKDPISVLDFVLQFWM---DDVKGCTMAHINAEKPAKD-GQCRGYFTQLVQDL 186
            .:..|...::...|  .|..|.:..|:.   |.:.|         |.||: |....:|||::...
 Frog   163 GFSCGENLFMASYK--ASWEDVIRAFYSEIEDFLYG---------KGAKEVGLQILHFTQVMWFS 216

  Fly   187 AAHVGCAMMLRKGQ---TSGLYQYGVLCHFS-RGKIANELVYRASAHPGSRCYAGTHSIYEGLC- 246
            :..||||    ..|   |....::..:||:: .|...|..:...:..|...|.:   |...||| 
 Frog   217 SWLVGCA----AAQCPITDHSLEFYFVCHYAPAGNYGNVGIPYKTGKPCEDCKS---SCENGLCT 274

  Fly   247 -------------SPEEH--VNPNA 256
                         :|:.|  .:|.|
 Frog   275 NGCNFQNKFSNCDTPDTHCDTDPTA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/159 (25%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 39/161 (24%)
Crisp 261..314 CDD:369954 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.