DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and pi15a

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:227 Identity:54/227 - (23%)
Similarity:84/227 - (37%) Gaps:72/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYI 128
            :||:| |:.|.|....:|   |||.|..:.|.:.||..|:.....|.:                 
Zfish    69 MLAIL-DYHNKVRGKVFP---PASNMEYMVWDDTLAKTAEQWASTCIW----------------- 112

  Fly   129 YGSTKWLQLEKDPISVLDF--------------VLQF---WMDDVKGCTMAHINAEKPAKDGQCR 176
                     |..|.::|.|              :||.   |.|:||..:..:.....|....:|.
Zfish   113 ---------EHGPRNLLRFLGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCY 168

  Fly   177 G----YFTQLVQDLAAHVGCAMMLRKGQTSGLYQYG--------VLCHFS-RGKIANELVYRASA 228
            |    ::||:|...:..||||:    .....:..:|        ::|::| :|....|..|:...
Zfish   169 GPMCTHYTQMVWATSNKVGCAI----NTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGV 229

  Fly   229 HPGSRC---YAGTHSIYEGLCSPEEHVNPNAL 257
             |.|.|   |.|:.|  ..:|.|.  ||.|.|
Zfish   230 -PCSMCPPSYGGSCS--NNMCFPA--VNSNYL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 38/178 (21%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 37/176 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.