DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:264 Identity:60/264 - (22%)
Similarity:95/264 - (35%) Gaps:65/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLA 66
            |:.|::.:|.....:|...|       ||.:..|....:.|                    ..|.
Mouse    10 LWTLALYLIATRLPKAFGND-------LPRVPSILDPKFID--------------------AFLN 47

  Fly    67 VLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIY-G 130
            :.|:.|..|..       ||:.|..:.|.::||.|||...|.|....:.|::......:.|.: |
Mouse    48 IHNELRRKVQP-------PAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDYDFIG 105

  Fly   131 STKWL-QLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQ----CRGYFTQLVQDLAAHV 190
            ...:| ::|..|    :.|:..|.::         |.:....|..    ||.| ||||......:
Mouse   106 ENIYLGEIETQP----EDVVNNWYNE---------NTDYNFVDNTCSKICRNY-TQLVWAKTFKI 156

  Fly   191 GCAMMLRKGQT---SGLYQYGVLCHFS-RGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEH 251
            |||:......|   :||:    :|::| .|...:...|| ...|.|.|  |.......||.|...
Mouse   157 GCAVSNCPNLTRYSAGLF----VCNYSPTGNFLDFRPYR-KGDPCSMC--GQRKCENSLCRPMNR 214

  Fly   252 VNPN 255
            ..|:
Mouse   215 KTPH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/161 (24%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 41/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.