DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CLEC18B

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001011880.2 Gene:CLEC18B / 497190 HGNCID:33849 Length:455 Species:Homo sapiens


Alignment Length:253 Identity:59/253 - (23%)
Similarity:89/253 - (35%) Gaps:69/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RAHLLAVLNDFRNTVAKGQYP------------------------HLR-------PASRMATLRW 94
            |.||||||.....|.....:|                        |.|       ||:.|..|.|
Human    10 RGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMRRLDW 74

  Fly    95 HEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQ----LEKDPISVLDF--VLQFWM 153
            .:.||.||:.....|.           ....|...|..:.||    ::..|..:..|  |:..|.
Human    75 SDSLAQLAQARAALCG-----------IPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWF 128

  Fly   154 DDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMML-RKGQTSGLYQYGVLCHFSRG- 216
              .:|...:|. |.:.|::..|. ::||||...::.:||...| ..|||:   ....:|.:|.| 
Human   129 --AEGQRYSHA-AGECARNATCT-HYTQLVWATSSQLGCGRHLCSAGQTA---IEAFVCAYSPGG 186

  Fly   217 --KIANELV--YRASAHPGSRCYAGTHSIYE------GLCS-PEEHVNPNALQLGELN 263
              ::..:.:  |:..|. .|.|.|.....::      |||. |......:....|.||
Human   187 NWEVNGKTIIPYKKGAW-CSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 45/190 (24%)
CLEC18BNP_001011880.2 SCP_euk 50..183 CDD:240180 36/150 (24%)
CLECT 310..443 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.