DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and LOC4576363

DIOPT Version :10

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_061504700.1 Gene:LOC4576363 / 4576363 VectorBaseID:AGAMI1_008439 Length:569 Species:Anopheles gambiae


Alignment Length:145 Identity:38/145 - (26%)
Similarity:58/145 - (40%) Gaps:27/145 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSY-VSYIYGSTKWLQLEKD----PISVLDFVL 149
            |.|..|:||       :|......:..:..|.|:| .:..||...:.....|    | |..| |.
Mosquito   442 ADLILHKEL-------VRDAQQWAEILARDDRFTYRQNSKYGENLYCLWSSDRNARP-SARD-VC 497

  Fly   150 QFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQT-SGLYQYGVLC-H 212
            :.|.::||..... :......|.||    |||:|......:|..|    ||| ||  :..|:| :
Mosquito   498 RSWYEEVKQYAFT-VEPRAAIKGGQ----FTQMVWKGTKELGVGM----GQTRSG--KVIVVCTY 551

  Fly   213 FSRGKIANELVYRAS 227
            :.||.:..:.:...|
Mosquito   552 YPRGNVLGQFLGNVS 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 35/130 (27%)
LOC4576363XP_061504700.1 None

Return to query results.
Submit another query.