DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Ag5r

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:244 Identity:74/244 - (30%)
Similarity:120/244 - (49%) Gaps:9/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYP 81
            |.:||||.|. | ....::.|.|.|.:..||.|:|.::......:..|:|..|::||.:|.|...
  Fly    17 ASATDYCKKS-C-GSTKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVARTNEYRNHIAGGLNA 79

  Fly    82 HLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQLEKDPISV-- 144
            :|..|.||||::|::|||.||...::.|....|.|.|||.|.:...   :..|:.. .:|::|  
  Fly    80 NLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQ---NLAWMGY-YNPLNVTH 140

  Fly   145 -LDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYG 208
             |::.:..|.|:......|:|:|.....:|...|:||.||.|....||||.............:.
  Fly   141 YLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFL 205

  Fly   209 VLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVNPNAL 257
            :.|:::...:....:|.:.:...|:|..||:..|:.|||.:|..|.|.|
  Fly   206 LACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEEYNVNNL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 47/155 (30%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 47/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440608
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.