DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG8483

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:235 Identity:55/235 - (23%)
Similarity:89/235 - (37%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLR 93
            |..|..|:|    :...:|..:.|........|:.:|...|..|..||.|:||....|..|..:.
  Fly     9 LTTIMIISC----EVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIV 69

  Fly    94 WHEELAGLAKFALRRCDYIDDYCSNTDEFSY---VSYIYGSTKWLQLEKDPISVLDFV--LQFWM 153
            |.:|||..|:.....|.:..|.....:.|:.   ::.|: ||..|..:..     ||.  :|.|.
  Fly    70 WDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIW-STAPLDADDG-----DFPSRIQSWF 128

  Fly   154 DDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKI 218
            ::|:..:.....:.|       .|:::|||....:.|||.....|..:.  |....:|::..|  
  Fly   129 NEVQKYSFGDAWSPK-------TGHYSQLVWGETSLVGCGYAEYKDTSK--YNKLYVCNYGPG-- 182

  Fly   219 ANELVYRA-----------SAHPGSRCYAGTHSIYEGLCS 247
            .|.:.|..           ...|.||        |:|||:
  Fly   183 GNVVGYNPYEVGKPSCSTYGMKPSSR--------YQGLCA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/157 (25%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 39/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.