DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and scpr-B

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster


Alignment Length:266 Identity:76/266 - (28%)
Similarity:119/266 - (44%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLA 66
            |.||:.|:.:     :|:.|||....||.:  ||||.|.|:|.|:|..:...:|...|.:. :|.
  Fly     6 LILLTSLLGI-----SLAADYCALPTCLDK--HIACNNKGNFSENCPKDVREVKIEPHHKL-ILN 62

  Fly    67 VLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYV------ 125
            :.|:.||.||.|:...|..|.|||.:.|.|||:.||...::.|:.:.|.|.:|:.|:|.      
  Fly    63 LFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAL 127

  Fly   126 -SYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCT---MAHINAEKPAKDGQCRGYFTQLVQDL 186
             .|....|::...|     ::...::.|..:....:   :|....|.|.|   ....||..|.:.
  Fly   128 FQYSGAETEYTDAE-----IIKEQIENWFAERSNASPEILASFPEELPNK---AVTKFTIAVAEK 184

  Fly   187 AAHVGCAMMLRKGQTSGLYQYGVL-CHFSRGKIANELVYRASAHPGSRCYAGTHS------IYEG 244
            ..|||||.:   ..:...|.:.|| |:|:...|..:.||.    ||.:...|..:      .|..
  Fly   185 NTHVGCAAV---RFSRDFYNHFVLTCNFATSNIVGQPVYT----PGEKATTGCKNRYGAAYDYPN 242

  Fly   245 LCSPEE 250
            ||..:|
  Fly   243 LCYAKE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 44/163 (27%)
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440605
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.