DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and scpr-C

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:118/262 - (45%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLND 70
            |::::..:...:|:.|||....||.:  ||||.|.|:|.|:|..:...:|...|.:. :|.:.|:
  Fly     5 SLILLTSLLGISLAADYCALPTCLDK--HIACNNKGNFSENCPKDVREVKIEPHHKL-ILNLFNE 66

  Fly    71 FRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYV-------SYI 128
            .||.||.|:...|..|.|||.:.|.|||:.||...::.|:.:.|.|.:|:.|:|.       .|.
  Fly    67 LRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYS 131

  Fly   129 YGSTKWLQLEKDPISVLDFVLQFWMDDVKGCT---MAHINAEKPAKDGQCRGYFTQLVQDLAAHV 190
            ...|::...|     ::...::.|..:....:   :|....|.|.|   ....||..|.:...||
  Fly   132 GAETEYTDAE-----IIKEQIENWFAERSNASPEILASFPEELPNK---AVTKFTIAVAEKNTHV 188

  Fly   191 GCAMMLRKGQTSGLYQYGVL-CHFSRGKIANELVYRASAHPGSRCYAGTHS------IYEGLCSP 248
            |||.:   ..:...|.:.|| |:|:...|..:.||.    ||.:...|..:      .|..||..
  Fly   189 GCAAV---RFSRDFYNHFVLTCNFATSNIVGQPVYT----PGEKATTGCKNRYGAAYDYPNLCYA 246

  Fly   249 EE 250
            :|
  Fly   247 KE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 44/163 (27%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440604
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.