DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG42564

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:245 Identity:74/245 - (30%)
Similarity:114/245 - (46%) Gaps:17/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYPHLRP 85
            |||:..||..|:.|:||....:..:.|..:|.::.....:...||...|:.|::||||.:..|.|
  Fly    54 DYCDPSLCHKELKHVACNASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGGFNGLSP 118

  Fly    86 ASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSY-----VSYIYGSTKWLQLEKDPISVL 145
            ||||.||:|:.|||.||:|.:|.|....|.|.|| :|:.     |.|.....|..:||    .:|
  Fly   119 ASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNT-KFTQNAGQTVGYRGIKGKLPELE----DIL 178

  Fly   146 DFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGY-FTQLVQDLAAHVGCAMMLRKGQTSGLYQYGV 209
            ..::..|:.:....:|.:| .:...::.|...| |.|:|.:.|..||||::  :....|..|...
  Fly   179 RDIIGVWLREKSRTSMVNI-MKYVEQESQSPKYNFLQIVLENAESVGCAIV--QQSRHGWIQTFF 240

  Fly   210 LCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPE---EHVNPNA 256
            .|::....:....||.........|..|.:..|..||:..   |.|.|.|
  Fly   241 ACNYGHAPVVGSPVYEPGKKAAESCKTGANPKYAHLCAESEVYEKVTPKA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 52/158 (33%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 52/157 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440566
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.