DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG8072

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:257 Identity:67/257 - (26%)
Similarity:115/257 - (44%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKF-----PMHMR 61
            |.|...|..:|..:..|:.|:|:...|..: .||.|.|...|||||      ::|     ..:.|
  Fly     4 LQLTLFLCKILFLRSILAIDFCDIKSCHGK-RHIGCDNNMMFDESC------LRFHGLVNMAYFR 61

  Fly    62 AHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRC--DYIDDYCSNTDEFSY 124
            .:||.:.|.:|..||...:..|.||.:|..|.|...|:.:|::.|:||  |..||.|..||:||.
  Fly    62 EYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSE 126

  Fly   125 VSYIYGSTKWLQ--LEKDPISVLDFVLQFWMDDVKGC-TMAHINAEKPAKDGQCRGYFTQLVQDL 186
            ..:.|....:.:  :.:..:..:..:.:.|:|::... .:|..:||         |....::.|.
  Fly   127 PHFNYAEDFYPRPVIRQSNVREMTILAEQWLDELYDLDDIATYSAE---------GEIRNIINDR 182

  Fly   187 AAHVGCAMMLRKGQTSGLY--QYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLC 246
            ::::|||    .||...|:  .:.::|::|.|......:|.......:.|..|....|..||
  Fly   183 SSYMGCA----AGQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPNGQSDEYPNLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 41/159 (26%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 41/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.