DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG34002

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:263 Identity:78/263 - (29%)
Similarity:126/263 - (47%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLYLLSVLIIVLISQEALSTDYCNKDLCLPE--ITHIACRNYGDFDESCGSEAIIMKFPMHMRAH 63
            :|.|..:.::.|:.:    |:||:...|..:  :.||.|.|.|.:...||.:..|:..|.|::..
  Fly    11 LLLLFGLNLVFLLPE----TNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKL 71

  Fly    64 LLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCD-YIDDYCSNTDEFSYVSY 127
            :|...|.:|:.||.||...|..|:||..|:|..|||.||...::||| ...|:|.:|:|||..||
  Fly    72 ILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSY 136

  Fly   128 --IYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCR-----GYFTQLVQD 185
              :|...|   .::|...::...|..|.|..|     |:::.. ..||...     |:|.:::..
  Fly   137 HAVYNKFK---AKEDTFRIVRSQLNAWYDQYK-----HVSSSS-LIDGLSTAKKEIGHFLRMIVG 192

  Fly   186 LAAHVGCAM-MLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPE 249
            .:..:|||: .:.||   |.....:.|.:|.....|.|:|..|..||..|..|.:..::.||:..
  Fly   193 PSNRLGCAIASIEKG---GWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDT 254

  Fly   250 EHV 252
            |.|
  Fly   255 EPV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 48/161 (30%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 48/161 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455076
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.