DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG34049

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:170 Identity:35/170 - (20%)
Similarity:68/170 - (40%) Gaps:46/170 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IMKFPMHMRAHL-LAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYC 116
            |.|.|:..|..: .|||.:      ..:|..|..|:   .|:..|:|          |.|..::.
  Fly   134 IYKIPIIRRKPIKQAVLRE------TNKYRRLHNAN---PLKMDEKL----------CSYAQEWA 179

  Fly   117 SNTDEFSYV----SYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRG 177
            .:..:.:.:    :.:||. ..:::.:...|| |.:|:.|..:     ..:.:..||..: ...|
  Fly   180 DHLADLNKLETRPNPLYGE-NIMRVRRSKFSV-DQILKLWYQE-----KYNYDYLKPGFN-LYTG 236

  Fly   178 YFTQLV----QDLAAHVGCAMMLRKGQTSGLYQYGVLCHF 213
            :|||||    :.|...|.|       ..|.::   ::|::
  Fly   237 HFTQLVWRESEFLGVGVAC-------DVSSIW---IVCNY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 32/162 (20%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.