DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG3640

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:256 Identity:76/256 - (29%)
Similarity:127/256 - (49%) Gaps:6/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLA 66
            ::.:.::|:.|.|..|.|.|||.:..|.....|:||.|.|.|...||.||.::.....::|.::.
  Fly     6 VWFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVH 70

  Fly    67 VLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGS 131
            .:|.:||.||.|......||.|||::||..|||.||:.|.:||....|.|.||..|.:|..:.|.
  Fly    71 QVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGH 135

  Fly   132 TKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMML 196
            ..:...:...:.:|...:..|.......: ..:.|..|:.:   ...|.||:|:.:.|:||. :|
  Fly   136 VIFSAGKHSDLELLRHKISNWFGQYMRAS-KDLQAADPSSN---ISSFRQLIQESSTHMGCG-VL 195

  Fly   197 RKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVNPNAL 257
            |:......:|..::|:|:|..:..|.||:... ..:.|.:|.:..|..||:.:|..:.||:
  Fly   196 RQRSHMLWHQQFIVCNFARRNMPREQVYQVGV-AATGCRSGRNPRYPNLCALQEEYDVNAV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 44/152 (29%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440569
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.