DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:173 Identity:40/173 - (23%)
Similarity:71/173 - (41%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRC-----DYIDDYCSNTDEFSYVSYI 128
            |:.|.||    :|   |...:..:.|...|:..|:...::|     .::|....:...|:.:   
  Rat    61 NELRGTV----FP---PGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHPVFTDI--- 115

  Fly   129 YGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCA 193
             |...|:..|||  ......::.|.::.|  :..::| :...:|..| .::.|||.|.:..||||
  Rat   116 -GENMWVGPEKD--FTATNAIRSWHEERK--SYNYVN-DTCIEDEDC-SHYIQLVWDHSYKVGCA 173

  Fly   194 MMLRKGQTSGLYQYGVL--CHFSRGKIANELVYRASAHPGSRC 234
              :......|...|..|  |:::.|.......|:|... .|||
  Rat   174 --VTPCAKVGAITYAALFICNYAPGGTLTRRPYQAGQF-CSRC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 34/151 (23%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 34/154 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.