DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Crisp2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:191 Identity:43/191 - (22%)
Similarity:82/191 - (42%) Gaps:24/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 MHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEF 122
            :.::..::|..|:.|..|:.       |.|.:..:.|:.:.|..|:.....|  |.::.|..|. 
  Rat    35 IQVQREIIAKHNELRRQVSP-------PGSNILKMEWNVQAAANAQKWANNC--ILEHSSTEDR- 89

  Fly   123 SYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLA 187
             .::...|..  |.:..||.| ...|:|.|.::.:.....     ..||.....|::||||...:
  Rat    90 -KINIKCGEN--LYMSTDPTS-WRTVIQSWYEENENFVFG-----VGAKPNSAVGHYTQLVWYSS 145

  Fly   188 AHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASA-HPGSRCYAGTHSIYEGLCS 247
            ..|||.:.....|.:..|.|  :||:.  .:.|.::.:::. |.|:.|.:..::...|||:
  Rat   146 FKVGCGVAYCPNQDTLKYFY--VCHYC--PMGNNVMKKSTPYHQGTPCASCPNNCDNGLCT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 36/152 (24%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 36/158 (23%)
Crisp 189..243 CDD:400739 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344765
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.