DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CLEC18A

DIOPT Version :10

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_047290014.1 Gene:CLEC18A / 348174 HGNCID:30388 Length:476 Species:Homo sapiens


Alignment Length:261 Identity:56/261 - (21%)
Similarity:86/261 - (32%) Gaps:85/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RAHLLAVLNDFRNTVAKGQYP------------------------HLR-------PASRMATLRW 94
            |.||||||.....|.....:|                        |.|       ||:.|..|.|
Human    10 RGHLLAVLLALLGTAWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMRRLDW 74

  Fly    95 HEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTK--WLQLEKDPISVLDF--VLQFWMDD 155
            .:.||.||:.....|        .|...|..|.::.:.:  | .::..|..::.|  |:..|.  
Human    75 SDSLAQLAQARAALC--------GTPTPSLASGLWRTLQVGW-NMQLLPAGLVSFVEVVSLWF-- 128

  Fly   156 VKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMML----------------------RK 198
            .:|...:|. |.:.|::..|. ::||||...::.:||...|                      ..
Human   129 AEGQRYSHA-AGECARNATCT-HYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVN 191

  Fly   199 GQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCS-PEEHVNPNALQLGEL 262
            |:|...|:.|..|......::.  .::|..|.|            |||. |......:....|.|
Human   192 GKTIVPYKKGAWCSLCTASVSG--CFKAWDHAG------------GLCEVPRNPCRMSCQNHGRL 242

  Fly   263 N 263
            |
Human   243 N 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 46/209 (22%)
CLEC18AXP_047290014.1 CAP_euk 50..183 CDD:349399 32/145 (22%)
EGF_CA 230..261 CDD:238011 3/14 (21%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.