DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG9400

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:278 Identity:78/278 - (28%)
Similarity:117/278 - (42%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LYLLSVLIIVLISQEAL-----------------STDYCNKDLC-------LPEITHIACRNYGD 42
            |:..:||:.||..::.|                 |..||...||       |..:.|.||.|.|.
  Fly    13 LWAPAVLLFVLACEKGLAGAQTLIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGS 77

  Fly    43 FDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALR 107
            |..:||.|..:::.....|..||.:.|..|:.:|.|.....|.|:.|..|||..||..:|....:
  Fly    78 FSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAK 142

  Fly   108 RCDYIDDYCSNTDEFSY----VSYIYGSTKWL--QLEKDPISVLDFVLQFWMDDVKGCTMAHINA 166
            ||.:..|.|.||..|.:    :.|.     |:  :.:.....:..||:. |..:.:....:.|:.
  Fly   143 RCQFAHDKCRNTPRFKFSGQNIGYF-----WIGREFKSHSRRMKSFVIN-WFREHQDANQSFIDR 201

  Fly   167 EKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPG 231
            ..|...|:..|:||.||.|....||||.:......|..:|:.:.|::....|.||.:|: |...|
  Fly   202 YHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQ-SGPAG 265

  Fly   232 SRCYAGTHSIYE---GLC 246
            |:|  ..|.|.|   .||
  Fly   266 SKC--PQHRISEKFPSLC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 44/158 (28%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 44/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440706
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.