DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG31296

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:240 Identity:68/240 - (28%)
Similarity:101/240 - (42%) Gaps:14/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYPHLR- 84
            |:|....|  ...::||.|...|...|...|..:....: |..||...|:|||..|.|:..:|: 
  Fly    24 DFCQLPYC--GTNNLACNNPSKFSVMCPPNARTLSMSTY-RNLLLIAFNEFRNYTASGKQKYLKA 85

  Fly    85 PASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQLEKD--PISVLDF 147
            .|:||:.|.:..||..||:.|:..|. ...:|.|:.||.||....|||.:|....|  .:.::..
  Fly    86 AAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLELMLR 149

  Fly   148 VLQFW--MDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVL 210
            ::|.|  ..|.....|.........|.|..:...  |:.|...||||:.|  :.....::.:..|
  Fly   150 IIQHWTRYADYVNIKMGVYMPTTLGKSGIAKALL--LMADRNTHVGCSAM--RFTVHSVHNFVFL 210

  Fly   211 CHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVNPN 255
            |.||........:||.|..||:.| ......|..||:..|:...|
  Fly   211 CAFSTDLFVERPIYRMSMRPGAAC-KRLDPTYSALCAVGENYENN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 46/157 (29%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 46/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.