DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG31286

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:200 Identity:41/200 - (20%)
Similarity:67/200 - (33%) Gaps:56/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLL 65
            ||.:.|::|:.|::.....                  ||:....::.|  .::.:.......|.:
  Fly     1 MLLIRSLVIVFLVAISEFD------------------RNFAINHDNAG--IVLREINKRRDRHGV 45

  Fly    66 AVLNDFRNTVAKGQYPHLRPASRMATLRWHEE-----LAGLAKF-----ALRRCDYIDDYCSNTD 120
            ..|. ..|.::||...:....|:.|||.:.:.     ...:.:|     ||.||           
  Fly    46 PKLT-LDNVLSKGCQSYAWKLSKSATLNYSDPTNKDYTESICRFEVKRGALSRC----------- 98

  Fly   121 EFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVK-GCTMAHINA------EKPAKDGQCRGY 178
                |...|...|:..|  || ...||....|...|. |...|:|||      .:....|..:|.
  Fly    99 ----VKNWYNGRKFDIL--DP-KAKDFTAMIWRSSVSLGYGDANINALQGVFVVRYTPPGNVKGL 156

  Fly   179 FTQLV 183
            :|..|
  Fly   157 YTDNV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 32/139 (23%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 31/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455166
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.