DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CG32679

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:120/265 - (45%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLL 65
            :|||:.::.....:|     :||:.:|| |...|:||:|.|.|...|..|.:      .:.||:.
  Fly    10 LLYLVLIIFTFTFAQ-----NYCDPELC-PSGRHVACQNSGRFVSGCSGEFV------QVDAHIP 62

  Fly    66 AVL---NDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSY--- 124
            .:|   |:.||.:|.|.......|.:|||:.|...||.||.:...:|....|.|.||:.:.|   
  Fly    63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQ 127

  Fly   125 -VSYIYGSTKWLQLEKDPISVLDFVLQ---FWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQD 185
             :|.::..:         :.|..|:.|   .|.|:.:..|...:. :...:.|...|:||.:|.:
  Fly   128 NLSILFTRS---------VDVAVFLRQRIAAWFDENRDATSGDME-DYQMRGGPAIGHFTTMVNE 182

  Fly   186 LAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEE 250
            ....|||| :.|....:.:....:.|:::...:.|..||||.. ..|.|..|.:|.|..||||.|
  Fly   183 RNNRVGCA-IARFTDANNVQATLLACNYAVTNVVNNPVYRAGT-AASECTTGRNSNYPNLCSPNE 245

  Fly   251 HVNPN 255
            ..|.|
  Fly   246 VYNYN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 41/162 (25%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 39/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440601
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.