DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Crispld1

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:228 Identity:49/228 - (21%)
Similarity:79/228 - (34%) Gaps:70/228 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKW 134
            |..|.:....||   .||.|..:.|..||...|:.....|                       .|
  Rat    67 DLHNKLRSQVYP---AASNMEYMTWDVELERSAESWAETC-----------------------LW 105

  Fly   135 LQLEKDPISVL-----------------DFVLQFWMDDVKGCTMAHINAEKPAKDGQCRG----Y 178
               |..|.|:|                 .|.:|.|.|:|:..:..:.:...|....:|.|    :
  Rat   106 ---EHGPTSLLPSIGQNLGAHWGRYRPPTFHVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTH 167

  Fly   179 FTQLVQDLAAHVGCAMMLRK-----GQ--TSGLYQYGVLCHFS-RGKIANELVYRASAHPGSRC- 234
            :||:|...::.:|||:.|..     ||  ...:|   ::|::| :|.......|: ...|.|.| 
  Rat   168 YTQVVWATSSRIGCAINLCHNMNIWGQIWPKAVY---LVCNYSPKGNWWGHAPYK-HGKPCSACP 228

  Fly   235 --YAGTHSIYEGLCSPE---EHVNPNALQLGEL 262
              :.|  ...|.||..|   ::..|...:..|:
  Rat   229 PSFGG--GCRENLCYKEGSDQYYTPQEEETNEI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 36/171 (21%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 36/171 (21%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.