DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Clec18a

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:216 Identity:51/216 - (23%)
Similarity:80/216 - (37%) Gaps:38/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYI 128
            :|...|..|:.|    :|   .|:.|..:.|.|.||.||:.....|.     .|.|...:.....
  Rat    78 ILTTHNRLRSQV----HP---SAANMQRMDWSESLAQLAQARAALCG-----TSATPNLAATLRN 130

  Fly   129 YGSTKWLQLEKDPISVLDF--VLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVG 191
            .....| .::..|:....|  |:..|.  .:|....|.:|| .|.:..| .::||||...::.:|
  Rat   131 TPDVGW-NVQLLPMGSASFVEVVNVWF--AEGLQYRHGSAE-CAHNATC-AHYTQLVWATSSQLG 190

  Fly   192 CAMMLRKGQTSGLYQYGV---LCHFSRG---KIANELVYRASAHPG-SRCYAGTHSIYE------ 243
            |..     |...:.|...   :|.:|.|   :|..:::......|. |.|.|.....::      
  Rat   191 CGW-----QPCFVDQVATEAFVCAYSPGGNWEINGKMIAPYKKGPWCSLCTASVSGCFKAWDHAG 250

  Fly   244 GLCS-PEEHVNPNALQLGELN 263
            |||. |......:...||.||
  Rat   251 GLCEVPRNPCRMSCRNLGHLN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 36/154 (23%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 36/154 (23%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.