DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Glipr1

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:210 Identity:47/210 - (22%)
Similarity:81/210 - (38%) Gaps:51/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLN 69
            :.||:.|::...:.::.:......||:||:      .||.|.|                 :.|.|
  Rat     1 MQVLLAVMVWMASSASGFSYTASTLPKITN------EDFIEEC-----------------VEVHN 42

  Fly    70 DFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIY---GS 131
            .||:..    ||   ||..|..:.|..:||.:||...:.|    .:..|....|.:...:   |.
  Rat    43 HFRSKA----YP---PAGNMLYMSWDPKLAQIAKAWAQSC----VFQHNPQLHSRIHPNFTGLGE 96

  Fly   132 TKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCR---GYFTQLVQDLAAHVGCA 193
            ..||. .....||...:|. |.::.:....:         .|:|:   |::||:|...:..:|||
  Rat    97 NIWLG-SLSLFSVRAAILA-WFEESQYYDFS---------TGKCKKVCGHYTQIVWADSYKIGCA 150

  Fly   194 MMLRKGQTSGLYQYG 208
            :.|.....:.:..||
  Rat   151 VQLCPRGANFICNYG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 36/154 (23%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 40/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.