DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Pi16

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:233 Identity:51/233 - (21%)
Similarity:91/233 - (39%) Gaps:59/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SCGSEAIIMKFPMHMRAHLL---------AVLNDFRNTVAKGQYPHLR-----PASRMATLRWHE 96
            ||....::.:.|:.:...||         |:..|.:.|:.: .:.|.|     |||.|..:||.:
  Rat     4 SCSPWVMLPQLPLLLLLLLLLLTATGPATALTEDEKQTMVE-LHNHYRAQVSPPASDMLQMRWDD 67

  Fly    97 ELAGLAKFALRRCDY---------IDDYCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFW 152
            |||..||...::|.:         .::..:.|||...|....|:                    |
  Rat    68 ELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGN--------------------W 112

  Fly   153 MDDVKGCTMAHINAEKPAKD-GQCRGYFTQLVQDLAAHVGCAM----MLRKGQTSGLYQYGVLCH 212
            .::.:     :.|......| ||..|::||:|......:||..    .|:..:.:.::.  ::|:
  Rat   113 HEEHE-----YYNLSTATCDPGQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHL--LVCN 170

  Fly   213 FS-RGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPE 249
            :. .|.:.....|:... |.|:|..| :|....||.||
  Rat   171 YEPPGNVKGRKPYQEGT-PCSQCPLG-YSCVNSLCEPE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 37/180 (21%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.