DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:261 Identity:57/261 - (21%)
Similarity:96/261 - (36%) Gaps:86/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LYLLSVLIIVLISQEALSTDYCNKDLCLPEIT--HIACRNYGDFDESCGSEAIIMKFPMHMRAHL 64
            |::|.:.::...|.:            :|.||  |        |.::|            :.|| 
Human    95 LWILGLCLVATTSSK------------IPSITDPH--------FIDNC------------IEAH- 126

  Fly    65 LAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIY 129
                |::|..|..       ||:.|..:.|.:.||.:||....:|.:..:.|.:.....|.::.|
Human   127 ----NEWRGKVNP-------PAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEY 180

  Fly   130 -GSTKWLQ-----LEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAA 188
             |...||.     ..:..|:......||:..|...|:..            | |::||||...:.
Human   181 VGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRV------------C-GHYTQLVWANSF 232

  Fly   189 HVGCAMML---RKGQTSGLYQYGVLCHFS-RGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPE 249
            :||||:.:   ..|.::.::    :|::. .|..||...|..    |..|         .|||.|
Human   233 YVGCAVAMCPNLGGASTAIF----VCNYGPAGNFANMPPYVR----GESC---------SLCSKE 280

  Fly   250 E 250
            |
Human   281 E 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 37/161 (23%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151312
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.