DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and PI16

DIOPT Version :10

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_699201.2 Gene:PI16 / 221476 HGNCID:21245 Length:463 Species:Homo sapiens


Alignment Length:184 Identity:42/184 - (22%)
Similarity:74/184 - (40%) Gaps:48/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQLEK-----DPISVL 145
            ||.|..:||.||||..||...|:|                  ::|..|    |:     :..::.
Human    51 ASDMLHMRWDEELAAFAKAYARQC------------------VWGHNK----ERGRRGENLFAIT 93

  Fly   146 D------FVLQFWMDDVKGCTMAHIN-AEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSG 203
            |      ..::.|..:     ..|.| :......||..|::||:|......:||.....: :..|
Human    94 DEGMDVPLAMEEWHHE-----REHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCE-KLQG 152

  Fly   204 LYQYGV---LCHFS-RGKIANELVYRASAHPGSRCYAGTH---SIYEGLCSPEE 250
            :.:..:   :|::. .|.:..:..|:... |.|:|.:|.|   |:.|.:.|||:
Human   153 VEETNIELLVCNYEPPGNVKGKRPYQEGT-PCSQCPSGYHCKNSLCEPIGSPED 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 30/142 (21%)
PI16NP_699201.2 CAP_PI16_HrTT-1 33..166 CDD:349405 30/142 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..408
O-glycosylated at one site 386..395
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.