DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and scl-27

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_503189.2 Gene:scl-27 / 191204 WormBaseID:WBGene00022638 Length:200 Species:Caenorhabditis elegans


Alignment Length:197 Identity:43/197 - (21%)
Similarity:75/197 - (38%) Gaps:38/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLAVLNDFRNTVAKGQYPH---LRPASRMATLRWHEELAGLAKFALRRCD-----YIDDYCSNTD 120
            ::.|.|:..|.||.|:|.:   ...||:|..::|::.||.........|.     |:..:...  
 Worm    27 IVKVHNELGNDVACGKYQNHSDYPKASQMMMMKWNQSLAEAVGNVKHSCQQLKERYLKKFIKG-- 89

  Fly   121 EFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQD 185
            |..|..|.|.:.      .|.:...|.:|:  ..:....|.|:...|:          |.:::.|
 Worm    90 ENLYRVYFYNTV------VDGLQERDEILR--RSEKAVSTGANFEVER----------FHKILHD 136

  Fly   186 LAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGT------HSIYEG 244
            ....:||:....:.......:| .:|.:|  .|.|..:|.. ..|.|:|..||      :|.:..
 Worm   137 KVTSIGCSYKNCENDQGYDMRY-FICKYS--PIDNGDMYHV-GEPCSQCPVGTSCNQNANSEFFN 197

  Fly   245 LC 246
            ||
 Worm   198 LC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 31/157 (20%)
scl-27NP_503189.2 CAP_euk 27..164 CDD:349399 31/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.