DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and scl-10

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_502498.1 Gene:scl-10 / 186049 WormBaseID:WBGene00009891 Length:212 Species:Caenorhabditis elegans


Alignment Length:248 Identity:51/248 - (20%)
Similarity:79/248 - (31%) Gaps:72/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQY---PHLRP-AS 87
            :||  :....|....:|.|: |...|:.:.            |..|:.:|.|:|   ...:| ||
 Worm     8 ICL--LIFSFCETLCEFSET-GKNYILSRH------------NYLRSQIALGKYVAGNSTKPSAS 57

  Fly    88 RMATLRWHEELAGLAKFALRRCDYIDDYCSN--TDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQ 150
            .|..|.|...|...|:          ||.:.  |...:..:.|..:..|                
 Worm    58 NMMKLIWDTTLETTAQ----------DYSTGCPTGHSASRANIGENMYW---------------- 96

  Fly   151 FWMDDVKGCTMAHINAEKPAKDGQCR--------------------GYFTQLVQDLAAHVGCAMM 195
             |...|...|.|.:...:.|...:..                    |:.||:.......:||.:.
 Worm    97 -WTSPVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGIS 160

  Fly   196 LRKGQTSGLYQYGVLCHFS-RGKIANELVYRASAHPGSRCYAGTH-SIYEGLC 246
            .....:.|. ||.|:|.:| .|......:|: |....|.|..||: ....|||
 Worm   161 KCSSDSFGT-QYVVVCLYSPAGNYIGMDIYK-SGETCSNCPDGTNCESSTGLC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 33/178 (19%)
scl-10NP_502498.1 SCP 25..179 CDD:214553 35/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.