DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and C07A4.3

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:135 Identity:28/135 - (20%)
Similarity:43/135 - (31%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IYGSTKWLQLEKDP--ISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHV 190
            :|...|.|:.:.||  .|:.|  |:.|:........||.::.....|........:...::|.|.
 Worm    23 VYMQNKSLEDKLDPAEYSIKD--LKKWIVHFHNKYRAHHSSPAVTVDSNLTNLAQKWSDEMAFHK 85

  Fly   191 GCAMMLRKGQTSGLYQYGVLCHFSRGKIANELV-YRASAHPGSRCYAGT--HSIY-EGLCSPEEH 251
            .|                 |.|....|....|. :.:|..|..:..|..  |..| ||.......
 Worm    86 KC-----------------LVHEQPSKYGENLTSFASSKFPSPKTCAAALIHGFYTEGYGFNYTR 133

  Fly   252 VNPNA 256
            .||.:
 Worm   134 FNPGS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 17/87 (20%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.