DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and scl-23

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_499859.3 Gene:scl-23 / 182028 WormBaseID:WBGene00015246 Length:330 Species:Caenorhabditis elegans


Alignment Length:230 Identity:56/230 - (24%)
Similarity:88/230 - (38%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AIIMKF-PMHMRAHLLAVL--------NDFRNTVAKGQY----PHLRPASRMATLRWHEELAGLA 102
            ::|.|. |.:.|.:|.|.|        |:.|:.||.|||    .:|.||..|..|.|..||...|
 Worm   103 SVITKMAPAYCRLNLPARLQNLILDKHNEIRSQVALGQYAVDDDYLPPADNMVKLDWDCELELEA 167

  Fly   103 KFALRRCDYIDD----YCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVL---QFWMDDVKGCT 160
            :...::|:...:    ..:..||      :.|...:.....|.:.|...||   |...|::   .
 Worm   168 QQRAQQCNLQKENSGRQMNGWDE------VRGENAFYFRTTDGLDVSGAVLKGIQRMGDEI---A 223

  Fly   161 MAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMM----LRKGQTSG-LYQYGVLCHFSRGKIAN 220
            :|.|...|.::.....|:.||::......:|||:.    .:.|...| .|...|..::..|.   
 Worm   224 IAGIKNLKLSRYDSRIGHATQILWKETRKLGCAVQECPARQDGSLDGQKYNVAVCKYYPTGN--- 285

  Fly   221 ELVYRAS--------AHPGSRCYAGTH-SIYEGLC 246
              |:::|        ....|.|..||. ....|||
 Worm   286 --VFKSSTPTSIYSVGDVASACSEGTFGDPSTGLC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 43/176 (24%)
scl-23NP_499859.3 CAP_euk 122..281 CDD:349399 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157363
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.760

Return to query results.
Submit another query.