DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and vap-2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:258 Identity:53/258 - (20%)
Similarity:89/258 - (34%) Gaps:75/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAK 77
            :..|.|:...|||.    .||.:             .:.||           |...|:.|.::|.
 Worm    85 LDDELLTEHVCNKS----TITQL-------------QQEII-----------LTTHNELRRSLAF 121

  Fly    78 GQYPHLR----PASRMATLRWHEELAGLAKFALRRC--DYIDDYC--SNTDEFS-YVSYIYGSTK 133
            |:..:.|    .|..|..|.|..|||.||......|  .::....  ||...|. :..|..|...
 Worm   122 GKQRNKRGLMNGARNMYKLDWDCELASLAANWSTSCPQHFMPQSVLGSNAQLFKRFYFYFDGHDS 186

  Fly   134 WLQLEKDPISVLDFVLQFW--MDDVKGCTMAHINAEKPAKDGQCRGYF--TQLVQDLAAHVGCAM 194
            .:.:..        .:::|  ..:.||      |.::..:....|.||  ..:.:.....|||:.
 Worm   187 TVHMRN--------AMKYWWQQGEEKG------NEDQKNRFYARRNYFGWANMAKGKTYRVGCSY 237

  Fly   195 MLRKGQTSGLYQYGVLCHFS-RGKIANELVYR----------ASAHPGSRCYAGTHSIYEGLC 246
            ::.....|.|:    .|.:: :.:...|::|.          ...:|||:|.     :.||||
 Worm   238 IMCGDGESALF----TCLYNEKAQCEKEMIYENGKPCCEDKDCFTYPGSKCL-----VPEGLC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 34/165 (21%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553 36/177 (20%)
SCP 315..468 CDD:214553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.