DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Crispld2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:239 Identity:59/239 - (24%)
Similarity:88/239 - (36%) Gaps:72/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PMHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDE 121
            ||..|..:|.:.|..|..|    ||   |||.|..:.|.|||...|....:||            
  Rat    52 PMSDRQEILMLHNKLRGQV----YP---PASNMEYMTWDEELERSAAAWAQRC------------ 97

  Fly   122 FSYVSYIYGSTKWLQLEKDPISVL-----------------DFVLQFWMDDVKGCTMAHINAEKP 169
                       .|   |..|.|:|                 .|.:|.|.|:||..|..:.:...|
  Rat    98 -----------LW---EHGPASLLVSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECNP 148

  Fly   170 AKDGQCRG----YFTQLVQDLAAHVGCAMMLRKGQT-------SGLYQYGVLCHFS-RGKIANEL 222
            ....:|.|    ::||:|......:|||:...:..:       :.:|   ::|::| :|....|.
  Rat   149 WCPERCSGAMCTHYTQMVWATTNKIGCAVHTCRSMSVWGDIWENAVY---LVCNYSPKGNWIGEA 210

  Fly   223 VYRASAHPGSRC---YAGTHSIYEGLCSPEEHVNPNALQLGELN 263
            .|: ...|.|.|   |.|  .....||..|||.:... ::.|:|
  Rat   211 PYK-HGRPCSECPSSYGG--GCRNNLCYREEHYHQKP-EVDEMN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 41/180 (23%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 41/180 (23%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.