DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and glipr1a

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:206 Identity:43/206 - (20%)
Similarity:78/206 - (37%) Gaps:50/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSY 124
            :|.|     |..|::|:.       .|:.|..:.|...||..|:...|.|.:..:......:..:
Zfish    36 VREH-----NQNRSSVSP-------TAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVH 88

  Fly   125 VSY-IYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCR-----GYFTQLV 183
            .:: ..|...|........:|...|.. |::::|         :....:.||.     |::||:|
Zfish    89 PTFTTVGENIWAGAPYSRFTVKSAVFS-WVNELK---------DYNYNNNQCNDKKVCGHYTQVV 143

  Fly   184 QDLAAHVGCAMMLRKGQT--SGLYQ------YGVL--CHF-SRGKIANELVYRASAHPGSRC--Y 235
            ...:..||||:     ||  :|:.:      .||:  |:: :.|..|....|:    .|:.|  .
Zfish   144 WADSYKVGCAV-----QTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYK----QGASCSGC 199

  Fly   236 AGTHSIYEGLC 246
            .|:......||
Zfish   200 GGSDKCERNLC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 35/169 (21%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.