DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and LOC101883528

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:208 Identity:42/208 - (20%)
Similarity:81/208 - (38%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VLN--DFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIY 129
            :||  |..|.:.....|   .|:.|..:.|.|.:..:|:....:|  |.|:..:.:..:....::
Zfish    28 ILNIVDLHNELRSQVQP---SAAFMQKVVWDETIRLVAEGYAAKC--IWDHNPDLEHLTMGENLF 87

  Fly   130 GSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCA- 193
            ..|       .|.:....|:.::.:::.    .:.|....|:|..| |::||||......:||| 
Zfish    88 VGT-------GPFNATKAVMDWFNENLD----YNYNTNDCAEDKMC-GHYTQLVWANTTKIGCAS 140

  Fly   194 --------MMLRKGQTSGLYQYGVLC-HFSRGKIANELVYRASAHPGSRCYAGTHS---IYEGLC 246
                    :...|...       ::| ::.:|.|..:..|. |....|:|.....:   :.|.|.
Zfish   141 YFCDTLEKLHFEKATL-------LICDYYPQGNIEGQKPYE-SGESCSKCPEECENNICVMENLF 197

  Fly   247 SPEEHVNPNALQL 259
            .|.|..:|.:.|:
Zfish   198 PPFEDTDPKSTQM 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 30/158 (19%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 30/157 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.