DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and LOC100536500

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:206 Identity:48/206 - (23%)
Similarity:80/206 - (38%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCD---------YIDDY 115
            ::..::.|.|.||..|...       ||.|..:.|.:.:|..|:..:.:|:         .::.|
Zfish    39 VQQEIVDVHNAFRRAVQPS-------ASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGY 96

  Fly   116 CSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKP--AKDGQCRGY 178
            ....:.|...    |.:.|       .||:|    .|..:|.       |.:.|  :.:||..|:
Zfish    97 EMGENLFKAT----GISSW-------TSVVD----AWHSEVN-------NYKYPIGSINGQATGH 139

  Fly   179 FTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRA----SAHP---GSRCYA 236
            :||:|...:..||||:.    |....|.||  ||:          |||    :..|   ||.|.:
Zfish   140 YTQVVWYSSYEVGCAVT----QCGSNYFYG--CHY----------YRAGNFRTVPPYSLGSPCAS 188

  Fly   237 GTHSIYEGLCS 247
            ..::..:.||:
Zfish   189 CPNNCEDNLCT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/163 (24%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.