DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and crispld2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:212 Identity:49/212 - (23%)
Similarity:75/212 - (35%) Gaps:64/212 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYV 125
            |..:|.:.|..|..|    ||   .||.|..:.|.:||...|.....:|                
Zfish    61 REEILKLHNKLRGEV----YP---TASNMEYMIWDDELERSATSWAEQC---------------- 102

  Fly   126 SYIYGSTKWLQLEKDPISVL-----------------DFVLQFWMDDVKGCTMAHINAEKPAKDG 173
                      |.|..|..:|                 .:.:|.|.|:||..|..:.:...|....
Zfish   103 ----------QWEHGPQDLLMSIGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPE 157

  Fly   174 QCRG----YFTQLVQDLAAHVGCAMML--RKGQTSGLYQYGV--LCHFS-RGKIANELVYRASAH 229
            :|.|    ::||||......||||:.:  |......:::..|  :|::| :|....|..|: ...
Zfish   158 RCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQ-HGR 221

  Fly   230 PGSRCYAGTHSIYEGLC 246
            |.|:|...    |.|:|
Zfish   222 PCSQCPPS----YGGVC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/177 (22%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 39/177 (22%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.