DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and crisp2-like

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:242 Identity:52/242 - (21%)
Similarity:84/242 - (34%) Gaps:57/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMAT 91
            :|:..:.|   ..|||...:          || :.......|.|..|.:.:...|   .|..|..
 Frog    11 ICISALFH---STYGDDGGT----------PM-LDTETQNYLVDLHNLLRRSVDP---TAKDMLK 58

  Fly    92 LRWHEELAGLAKFALRRCDYIDDYCSNT-----DEFSYV--SYIYGST---KWLQLEKDPISVLD 146
            :.|....|..|:.|..:|  :..:.|.|     |.|:||  ..||.:|   .|..          
 Frog    59 MEWSPGAALNAQNAAAKC--VMQHSSATERQIQDPFNYVCGENIYVTTAKPDWAA---------- 111

  Fly   147 FVLQFWMDDVKGCTM-AHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVL 210
             .:..|.::....|. ...|::|..      |::||:.......:||.:....|   ..|.|..:
 Frog   112 -AVNSWFNERNDFTYGVGPNSDKMI------GHYTQVAWAKTYLLGCGLAFCPG---NYYPYVSI 166

  Fly   211 CHF-SRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVNPNA 256
            ||: ..|.:.|.:  :.....|..|.:...|..:.||:.    ||.|
 Frog   167 CHYCPMGNMINSI--KTPYEAGEWCASCPESCEDKLCTS----NPTA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 35/164 (21%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 35/162 (22%)
Crisp 189..>205 CDD:312162 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.