DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and crisp1.11

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:186 Identity:42/186 - (22%)
Similarity:67/186 - (36%) Gaps:27/186 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGS 131
            ::.|..|...:...|..|   .|..:.|:|:.|..|......|   ....|..|:.:...:..|.
 Frog    62 IIIDTHNAYRRNASPSAR---NMLKMVWNEDAANNAASWSAGC---TGSHSPPDKRTIPGFSCGE 120

  Fly   132 TKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAE---KPAKDGQCRGYFTQLVQDLAAHVGCA 193
            .  |.|...|.|        |.:.||.....:.:.|   .|....|..|::||::...:..|||:
 Frog   121 N--LFLASYPAS--------WEEAVKAWFDENESFEYGVGPKSPDQVVGHYTQVMWYNSYMVGCS 175

  Fly   194 M-MLRKGQTSGLYQYGVLCHF-SRGKIANELVYRASAHPGSRCYAGTHSIYEGLCS 247
            : ...|.|    |:|..:|.: ..|.|  |.|.......|.:|.....:....||:
 Frog   176 VSYCPKSQ----YKYFYVCQYCPAGNI--EGVMNTPYKAGPKCADCVEACDNSLCT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 34/151 (23%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 34/152 (22%)
Crisp 212..263 CDD:400739 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.