DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and crispld1a

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:266 Identity:62/266 - (23%)
Similarity:91/266 - (34%) Gaps:89/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DFDESCGSEAIIMKFPMHMRA----HLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLA 102
            |.|:..|..  :|:.....||    .:.|:| |..|.:....||   |||.|..:.|..||...|
Zfish    43 DADDDAGDR--VMERQRGKRAITASDMQAIL-DLHNKLRGQVYP---PASNMEYMVWDNELERSA 101

  Fly   103 KFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFV-----------------LQ 150
            :.....|                       .|   |..|..:|..:                 :|
Zfish   102 EEWAETC-----------------------LW---EHGPAGLLPQIGQNLGVHWGRYRPPTSHVQ 140

  Fly   151 FWMDDVKGCTMAHINAEKPAKDGQCRG----YFTQLVQDLAAHVGCAM-----MLRKGQTSGLYQ 206
            .|.|:||..:..:.....|....:|.|    ::||||...::.:|||:     |...||......
Zfish   141 AWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHYTQLVWATSSRIGCAINVCYNMNVWGQIWAKAV 205

  Fly   207 YGVLCHFS-RGKIANELVYRASAHPGSRCYAGTHSIYEGLC--------------SPEEH----- 251
            | ::|::| :|   |...|....| |:.|.|...| |.|:|              ||.|.     
Zfish   206 Y-LVCNYSPKG---NWWGYAPYKH-GTSCSACPPS-YGGVCRENLCYKGDGKNRQSPSEETHERN 264

  Fly   252 -VNPNA 256
             :.|.|
Zfish   265 SIEPEA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 41/182 (23%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 39/174 (22%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.