DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and R3hdml

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:218 Identity:47/218 - (21%)
Similarity:87/218 - (39%) Gaps:66/218 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFS 123
            |:.|..::.|.|:.|.:....:|   ||:.|..:.|.|:||..|:....:|              
Mouse    57 HISARDMSALLDYHNHIRASVHP---PAANMEYMVWDEQLARSAEAWATQC-------------- 104

  Fly   124 YVSYIYGSTKWLQLEKDPI--------SVLDFVLQFWMDD--------VKGCTMAHINAEKPAKD 172
              .:.:|.::.::.....:        ||:|.| :.|.::        .|.||        |...
Mouse   105 --IWTHGPSQLMKYVGQNLSIHSGRFRSVVDLV-RSWSEEKRHYSFPAPKDCT--------PHCP 158

  Fly   173 GQCRG----YFTQLVQDLAAHVGCAMMLRKGQTSGLYQYG--------VLCHFS-RGKIANELVY 224
            ..|.|    ::||:|...::.:|||:    ...|.:..:|        ::|::: :|....|..|
Mouse   159 WLCSGPVCSHYTQMVWASSSRLGCAI----NTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPY 219

  Fly   225 RASAHPGSRCYAGTHSIYEGLCS 247
            :|    |..|.|...| |:|.|:
Mouse   220 KA----GKPCSACPPS-YQGNCN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 35/180 (19%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 34/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.