DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30480 and ro

DIOPT Version :9

Sequence 1:NP_001260976.1 Gene:CG30480 / 246640 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:250 Identity:49/250 - (19%)
Similarity:74/250 - (29%) Gaps:106/250 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PKHRHHHHHHRHHHHHERQENVEVVATEEVILVENAPKSRKHHHHKQRTSPPPPLPQ--TSPPFL 102
            |..:|..||  |||||..|            ||         |......||||.:..  .:.|.|
  Fly   118 PSQQHQQHH--HHHHHPPQ------------LV---------HQKLSYVSPPPAIAAGGAANPVL 159

  Fly   103 TPTEEVGFNVVWEPQAFWNQPSPNPSTDLDLSQDNEVVDAVETMDTTSASDEFTTVVFQSETKES 167
                         |.||   |:..||                   ....|..|:..:.:...||.
  Fly   160 -------------PHAF---PAGFPS-------------------DPHFSAGFSAFLARRRRKEG 189

  Fly   168 IRETQKHTRVVEEEIIIDQLDPPPYAPPPLQVQTGFFPVAQQPPLSPIAEVVQTDVVAESVEPPL 232
            .:..|:.|...|:.:.::                              .|..:.:.::.|....|
  Fly   190 RQRRQRTTFSTEQTLRLE------------------------------VEFHRNEYISRSRRFEL 224

  Fly   233 PPTGYIPRINLKPTETIVE--------NVEVIVPAQIQQE-PEFIPQPGFVARIV 278
            ..|       |:.|||.::        ..:.|..|||.|. ..|:...||::.|:
  Fly   225 AET-------LRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVANGFMSSIM 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669
roNP_524521.1 Homeobox 196..247 CDD:278475 10/87 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.