DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30480 and Scr

DIOPT Version :9

Sequence 1:NP_001260976.1 Gene:CG30480 / 246640 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:116 Identity:24/116 - (20%)
Similarity:46/116 - (39%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 PPEQFPFISR----ESLIVADDYVEVEEV--TPYNTAPHSPIVEVERLSEAESYVEIN---EVAP 728
            ||:.:|::.|    .|.:.|:...:.:..  |.|.|      :|:|:......|:...   |:|.
  Fly   301 PPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQT------LELEKEFHFNRYLTRRRRIEIAH 359

  Fly   729 VNTPPQRSVEVGFLPRPSLAETAVVVESVEVTPTPTPP-PSPALKLKIPPS 778
            .....:|.:::.|..|....:....:.|:.:.|....| ..|..:..|.||
  Fly   360 ALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQFDIHPS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669 17/92 (18%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.