DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ave and samd12

DIOPT Version :9

Sequence 1:NP_725413.1 Gene:ave / 246638 FlyBaseID:FBgn0050476 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_005159846.4 Gene:samd12 / 797592 ZFINID:ZDB-GENE-060503-192 Length:182 Species:Danio rerio


Alignment Length:98 Identity:36/98 - (36%)
Similarity:60/98 - (61%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TRTKTTRP------KAVYLWTVSDVLKWYRRHC-GEYTQYEQLFAQHDITGRALLRITDSSLQRM 70
            :.::.:||      |.|.||:..||.||.::|| .::..|...|.|||||||||:|:||..|:||
Zfish    79 SESELSRPGTVKLSKPVALWSQQDVCKWLKKHCPNQHQVYSDSFKQHDITGRALMRLTDRKLERM 143

  Fly    71 GVTDNRDREAIWREIVKQRLKTDIMEIRDMERL 103
            |:.....|:.|.:::::.|::.   |:|.::.|
Zfish   144 GIMQESQRQFILQQVLQLRVRE---EVRTLQLL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aveNP_725413.1 SAM_aveugle-like 21..94 CDD:188909 31/73 (42%)
samd12XP_005159846.4 SAM_aveugle-like 93..167 CDD:188909 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.