DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ave and samd10a

DIOPT Version :9

Sequence 1:NP_725413.1 Gene:ave / 246638 FlyBaseID:FBgn0050476 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001103868.1 Gene:samd10a / 570533 ZFINID:ZDB-GENE-080204-53 Length:175 Species:Danio rerio


Alignment Length:86 Identity:32/86 - (37%)
Similarity:50/86 - (58%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TKTTRP---KAVYLWTVSDVLKWYRRHC-GEYTQYEQLFAQHDITGRALLRITDSSLQRMGVTDN 75
            |..|.|   :.|.||:..||.:|.::|| ..|..|.:.|:.|.||||||||:....|:|||:.  
Zfish    77 TSPTLPCLSRPVVLWSQQDVCRWLKKHCPHNYLTYVEAFSHHAITGRALLRLNGEKLERMGLV-- 139

  Fly    76 RDREAIWREIVKQRLKTDIME 96
              :|.:.:|:::|.|:..:.|
Zfish   140 --QETLRQELLQQVLQLQVQE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aveNP_725413.1 SAM_aveugle-like 21..94 CDD:188909 28/73 (38%)
samd10aNP_001103868.1 SAM_aveugle-like 86..>144 CDD:188909 25/61 (41%)
SAM 88..>137 CDD:197735 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583646
Domainoid 1 1.000 59 1.000 Domainoid score I10662
eggNOG 1 0.900 - - E1_2A05R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479834at2759
OrthoFinder 1 1.000 - - FOG0002966
OrthoInspector 1 1.000 - - otm25677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20843
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3983
SonicParanoid 1 1.000 - - X2956
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.