DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ave and ave-1

DIOPT Version :9

Sequence 1:NP_725413.1 Gene:ave / 246638 FlyBaseID:FBgn0050476 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001022691.1 Gene:ave-1 / 3565044 WormBaseID:WBGene00044341 Length:102 Species:Caenorhabditis elegans


Alignment Length:79 Identity:27/79 - (34%)
Similarity:49/79 - (62%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RPKAVYLWTVSDVLKWYRRHCGEYT-QYEQLFAQHDITGRALLRITDSSLQRMGVTDNRDREAIW 82
            ||  :|.|:.:||.:|.||....:. :|...|.:|::|||.|:.::|..|:.:||..:.:|:.:.
 Worm    15 RP--IYFWSANDVDQWLRRKRPRFALKYAHFFLRHNVTGRVLVEMSDDDLREIGVETDDERQDLL 77

  Fly    83 REIVKQRLKTDIME 96
            .||.|::|.:|:.|
 Worm    78 LEIKKEKLYSDLDE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aveNP_725413.1 SAM_aveugle-like 21..94 CDD:188909 23/73 (32%)
ave-1NP_001022691.1 SAM_superfamily 15..89 CDD:387673 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160992
Domainoid 1 1.000 45 1.000 Domainoid score I8329
eggNOG 1 0.900 - - E1_2A05R
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I4052
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46471
OrthoDB 1 1.010 - - D1479834at2759
OrthoFinder 1 1.000 - - FOG0002966
OrthoInspector 1 1.000 - - oto18817
orthoMCL 1 0.900 - - OOG6_108143
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3983
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.