DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ave and Samd12

DIOPT Version :9

Sequence 1:NP_725413.1 Gene:ave / 246638 FlyBaseID:FBgn0050476 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_006521143.1 Gene:Samd12 / 320679 MGIID:2444518 Length:190 Species:Mus musculus


Alignment Length:96 Identity:38/96 - (39%)
Similarity:60/96 - (62%) Gaps:6/96 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TQNKTRTKTTRPKAVYLWTVSDVLKWYRRHC-GEYTQYEQLFAQHDITGRALLRITDSSLQRMGV 72
            |......|.::|  |.|||..||.||.::|| .:|..|.:.|.|||||||||||:||..|:|||:
Mouse    62 TAKSATVKLSKP--VALWTQQDVCKWLKKHCPNQYQLYSESFKQHDITGRALLRLTDKKLERMGI 124

  Fly    73 TDNRDREAIWREIVKQRLKTDIMEIRDMERL 103
            .....|:.|.:::::.:::.   |:|:::.|
Mouse   125 AQENQRQHILQQVLQLKVRE---EVRNLQLL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aveNP_725413.1 SAM_aveugle-like 21..94 CDD:188909 32/73 (44%)
Samd12XP_006521143.1 SAM_aveugle-like 72..146 CDD:188909 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839566
Domainoid 1 1.000 72 1.000 Domainoid score I9292
eggNOG 1 0.900 - - E1_2A05R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5217
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479834at2759
OrthoFinder 1 1.000 - - FOG0002966
OrthoInspector 1 1.000 - - otm43335
orthoMCL 1 0.900 - - OOG6_108143
Panther 1 1.100 - - LDO PTHR20843
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3983
SonicParanoid 1 1.000 - - X2956
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.