DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ave and SAMD15

DIOPT Version :9

Sequence 1:NP_725413.1 Gene:ave / 246638 FlyBaseID:FBgn0050476 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001010860.1 Gene:SAMD15 / 161394 HGNCID:18631 Length:674 Species:Homo sapiens


Alignment Length:112 Identity:31/112 - (27%)
Similarity:56/112 - (50%) Gaps:12/112 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EETINSTQNKTRTKTTRPKAVYL-WTVSDVLKWYRRHCGEYTQYEQLFAQHDITGRALLRITDSS 66
            :|.::........|.|..:..:| |...:|.:|..: .| :.||::.|..:.|:||.|:.:..|:
Human   521 KERVSEDDETQPEKGTELQFEHLNWDPEEVAEWISQ-LG-FPQYKECFITNFISGRKLIHVNCSN 583

  Fly    67 LQRMGVTDNRDREAIWR------EIVKQRLKTDI-MEIRDMERLNIY 106
            |.:||:|:..|.:||.|      ||.:...|..| :..||:  :.:|
Human   584 LPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDI--IGLY 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aveNP_725413.1 SAM_aveugle-like 21..94 CDD:188909 24/79 (30%)
SAMD15NP_001010860.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..448
ftsN 137..>310 CDD:274041
SAM_Samd14 543..609 CDD:188929 22/67 (33%)
SAM 544..607 CDD:197735 20/64 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.