DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ave and samd12

DIOPT Version :9

Sequence 1:NP_725413.1 Gene:ave / 246638 FlyBaseID:FBgn0050476 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_031760037.1 Gene:samd12 / 100489280 XenbaseID:XB-GENE-6073780 Length:176 Species:Xenopus tropicalis


Alignment Length:101 Identity:38/101 - (37%)
Similarity:60/101 - (59%) Gaps:6/101 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHC-GEYTQYEQLFAQHDITGRALLRITDSSL 67
            :|...|......|.|:|  |..||..||.||.|:|| .:|..|...|.:||||||||||:|:..|
 Frog    55 QTDPDTPKPNIVKLTKP--VAFWTQHDVCKWLRKHCPNQYQLYSDSFKEHDITGRALLRLTEKKL 117

  Fly    68 QRMGVTDNRDREAIWREIVKQRLKTDIMEIRDMERL 103
            :|||:|....|:.:.::::..:::.   |:|:::.|
 Frog   118 ERMGITQESQRQHVLQQVLHLKVRE---EVRNLQLL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aveNP_725413.1 SAM_aveugle-like 21..94 CDD:188909 30/73 (41%)
samd12XP_031760037.1 SAM_aveugle-like 70..144 CDD:188909 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9508
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479834at2759
OrthoFinder 1 1.000 - - FOG0002966
OrthoInspector 1 1.000 - - oto103704
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2956
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.