DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52b and Ir92a

DIOPT Version :9

Sequence 1:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:498 Identity:92/498 - (18%)
Similarity:160/498 - (32%) Gaps:156/498 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PDIDNGGPNSTSIKLQRNRRLVLLKEDFQPSNICNIYTQKEQYNIALVRENFTKSKSIYTCRYFQ 157
            ||...||..|.|.|         .|:|.:........:.....|..|..:.|..:..        
  Fly   165 PDPRRGGGASVSTK---------NKDDGEGGAGNKTTSPYRDINFELWTQKFVGAVG-------- 212

  Fly   158 DPNVDEVNLSGTKP---------IFIEQFQNMKGKAIRIVPDL--LPPRVMLYQDANDGELKMI- 210
              |:|.:.|....|         ::..:..|::.::: :|..:  :|..:..|..|..|::..| 
  Fly   213 --NLDALLLDAFLPNETFANRVELYPNKLLNLQRRSL-LVGSITYVPYTITNYVPAGQGDVDPIH 274

  Fly   211 -----------GYVANLITNFAQKVNATLQLDF--------LKPSTSITEISRMAKDDELDMGIT 256
                       |..||::..|.|..|..|:::.        :..:.|...:.....:..::|.|.
  Fly   275 PQWPNRSLTFDGAEANVMKTFCQVHNCHLRVEAYGADNWGGIYDNESSDGMLGDIYEQRVEMAIG 339

  Fly   257 LEASLNTSNLETSSYPYLLTSYCLMVQVPAKFP---------YNLVYALIVDPLVLGIIFVLFL- 311
            ...:......|| |:....:|..::...||..|         .|..:.:::..||:...|:.|: 
  Fly   340 CIYNWYDGITET-SHTIARSSVTILGPAPAPLPSWRTNIMPFNNRAWLVLISTLVICGTFLYFMK 403

  Fly   312 LLSVLLIY---------SQKMSWQDLSVANILLNDKSLRGLLGQSFPFPLNASKKLRLIF--TIL 365
            .:|..|.|         |:|:....|.:..:.:...|.          ||:..:.....|  |||
  Fly   404 YVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFIQQPSA----------PLSFDRFAPRFFLATIL 458

  Fly   366 CFASIMLTTMYEAYLQSFFTNP----P--------------SEPEICSFQDVGSYN--------- 403
            | |:|.|..:|...|:|..|.|    |              |.|.|.....|.|.:         
  Fly   459 C-ATITLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSIIWVHTVQSSDLETEQILAR 522

  Fly   404 -----------------------RRIAMSALEVNGLIKTNNSHFREIRMDDLEIFDN-------- 437
                                   .|::..:|.|...:.|.....|.:..||| .||.        
  Fly   523 NFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLHDDL-YFDYTRAVSIRG 586

  Fly   438 ---MPE-------CYELRDAFNLSYNYVVTGDRWRSYAEQQTL 470
               |||       |.|....|:....::   |::....:|:.|
  Fly   587 WILMPELNKHIRTCQETGLYFHWELEFI---DKYMDKKKQEVL 626



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.